Protein Info for CCNA_01571 in Caulobacter crescentus NA1000

Annotation: arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00014: arsenate reductase (glutaredoxin)" amino acids 8 to 120 (113 residues), 127 bits, see alignment E=2.5e-41 PF03960: ArsC" amino acids 11 to 118 (108 residues), 78.9 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 59% identical to ARSI2_SYNY3: Arsenate reductase ArsI2 (arsI2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 100% identity to ccr:CC_1503)

MetaCyc: 59% identical to arsenate reductase (glutathione/glutaredoxin) (Sinorhizobium meliloti)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8A8 at UniProt or InterPro

Protein Sequence (137 amino acids)

>CCNA_01571 arsenate reductase (Caulobacter crescentus NA1000)
MTDIAFPITIFHNPACGTSRNTVAMVQAAGYAPQVVEYLKTGWTREQLQDLAAKSGGSLR
ALMREKGTPAETLGLLADEVSDERLLDAMVEHPILVNRPIVVTPKGVKLCRPSEQVLDLL
DRKPEQFTKEDGEVVTP