Protein Info for CCNA_01568 in Caulobacter crescentus NA1000

Annotation: Kef-type K+ transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 409 to 434 (26 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 45 to 429 (385 residues), 166.7 bits, see alignment E=3.8e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1500)

Predicted SEED Role

"Cation:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9S1 at UniProt or InterPro

Protein Sequence (454 amino acids)

>CCNA_01568 Kef-type K+ transport system (Caulobacter crescentus NA1000)
MSDLLAHTLQTVADILGPHGPATKAAEHSYTPNDYSIHFFLQLAVILLACRVTGWFGKKF
LAQPQVVGEMIAGVVLGPSLLGLLFPDFQLSLFPKETRNILYVGAQLGVGLYMFLVGASF
QAGHFKTKARSAMSVSFAGIAAPFAIAVIITPFLLKVPGLFAPTITPGAATLFMGACIAL
TAFPMLARIINERGLQKTSLGTLSLTAGAFDDAVSWCVLAVVLAMFGGGPGVAVLAIGGG
LLWVLFVLTLGPKILAPLGRMVEREGELSAHALALVILAFCVSAFLMDAVGIHAIFGGFI
MGVVMPRGLLTQELKKKVEPLVVVLLLPMFFTYSGLNTRLDMVNSLDLLLIALGILACSI
LAKWGACYVAARATGEDHATAMGIGALMNSRGLMELIIINIGLQKGIIGPTLFAMLVLMA
IVTTMMASPLFEIVYGKKARERGELDAVPDAKRA