Protein Info for CCNA_01562 in Caulobacter crescentus NA1000

Annotation: 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxyphosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01081: Aldolase" amino acids 13 to 208 (196 residues), 117.3 bits, see alignment E=3.2e-38

Best Hits

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to ccs:CCNA_01562)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6Y5 at UniProt or InterPro

Protein Sequence (224 amino acids)

>CCNA_01562 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxyphosphogluconate aldolase (Caulobacter crescentus NA1000)
MVKDRMAVLTALMDQGVIPVFYHPDVEVCKNVIQACADGGAPCIEFTNRGDFASHVFYEV
TRYFAEADPRVIMGVGSIVDAPTAGIYIANGAKFVVGPILNADVAKVCNRRKIPYSPGCG
SASEISYAEELGCEIVKVFPGSSVGGPDFVKAVLGPMPWTRIMPTGGVDPDEASVKKWFG
AGIVAAGMGSKLITQEMLDAKDYAGISKKVRETVDLIKKVRGKA