Protein Info for CCNA_01562 in Caulobacter crescentus NA1000

Annotation: 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxyphosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01081: Aldolase
  • amino acids 13 to 208 (196 residues), 117.3 bits, E=3.2e-38

Best Hits

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to ccs:CCNA_01562)

Predicted SEED Role

No annotation

MetaCyc Pathways

• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• D-galacturonate degradation I (4/5 steps found)
• D-fructuronate degradation (3/4 steps found)
• superpathway of β-D-glucuronosides degradation (5/7 steps found)
• superpathway of hexuronide and hexuronate degradation (7/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16

Sequence Analysis Tools

See A0A0H3C6Y5 at UniProt or InterPro

Protein Sequence (224 amino acids)

>CCNA_01562 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxyphosphogluconate aldolase (Caulobacter crescentus NA1000)
MVKDRMAVLTALMDQGVIPVFYHPDVEVCKNVIQACADGGAPCIEFTNRGDFASHVFYEV
TRYFAEADPRVIMGVGSIVDAPTAGIYIANGAKFVVGPILNADVAKVCNRRKIPYSPGCG
SASEISYAEELGCEIVKVFPGSSVGGPDFVKAVLGPMPWTRIMPTGGVDPDEASVKKWFG
AGIVAAGMGSKLITQEMLDAKDYAGISKKVRETVDLIKKVRGKA