Protein Info for CCNA_01555 in Caulobacter crescentus NA1000

Annotation: altronate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 50% identical to UXAA_BACSU: Altronate dehydratase (uxaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01685, altronate hydrolase [EC: 4.2.1.7] (inferred from 100% identity to ccs:CCNA_01555)

MetaCyc: 51% identical to D-altronate dehydratase (Escherichia coli K-12 substr. MG1655)
Altronate dehydratase. [EC: 4.2.1.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

D-galacturonate degradation I (4/5 steps found)
superpathway of hexuronide and hexuronate degradation (7/10 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)

KEGG Metabolic Maps

Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6Y0 at UniProt or InterPro

Protein Sequence (502 amino acids)

>CCNA_01555 altronate dehydratase (Caulobacter crescentus NA1000)
MTKNTPAPGESIHAVDPRDHVATALRDLACGESVSAHGERFIVRADVPKGHKIATRVVRS
GDDVLKYGWPIGRATADIAVGDHVHVHNVITRLEGVEGYAFAPLPPAGAPSADTRTFQGF
RRKNGRAGTRNEIWVLCTVGCVANTARRIAEKANQRFAGRVDGVYAFPHPFGCSQLGDDL
AHTRKLIAALASHPNAGGVLILGLGCENNQLKALLESAPDIDRERLKGFTTQMVEDELED
GLAAVEALVEIAEKDRREPVPVSELVVGLKCGGSDGFSGITANPLVGRIADKVAEAGGTP
VLTEIPEIFGAENVLLQRAASREVFDAAVAVIDDFKRYFIEANQPIYENPSPGNIAGGIT
SLEEKSLGAVQKGGRAPLVEVLRYGETVGRHGLTLLEAPGNDAVSSTALTAAGATVILFT
TGRGTPLGFPAPTLKIASNSGLAQRKPGWIDFDAGQVLEGVSMDVAAENLMDLVIETASG
KTTKAELNGEREIALWKSGVTL