Protein Info for CCNA_01514 in Caulobacter crescentus NA1000

Annotation: C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details PF04290: DctQ" amino acids 28 to 157 (130 residues), 87.9 bits, see alignment E=2.7e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01514)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9L2 at UniProt or InterPro

Protein Sequence (166 amino acids)

>CCNA_01514 C4-dicarboxylate transport system, small permease component (Caulobacter crescentus NA1000)
MMLDSLAFISRWISRATLAFAAIGLIAMTGIIGWAVFARYSLGDAPAWAEQAALLLMVWF
VLLAAAVGVREQFHLGMSAATNAMPPFLRRLCRVVSLLAMAAFGLAMGVWGGELVARTWA
FDIPTLGVPRGAAYLPLPIAGWMSVFFALEHLICEARGRKVEPLWN