Protein Info for CCNA_01509 in Caulobacter crescentus NA1000

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to BEKAS_PSEAE: Beta-ketodecanoyl-[acyl-carrier-protein] synthase (PA3286) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to ccr:CC_1442)

MetaCyc: 64% identical to beta-ketodecanoyl-[acyl-carrier-protein] synthase (Pseudomonas aeruginosa PAO1)
RXN-13613 [EC: 2.3.1.207]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
fatty acid salvage (6/6 steps found)
fatty acid biosynthesis initiation (type II) (3/3 steps found)
superpathway of fatty acid biosynthesis initiation (4/5 steps found)
streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.207

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9K7 at UniProt or InterPro

Protein Sequence (371 amino acids)

>CCNA_01509 3-oxoacyl-(acyl-carrier-protein) synthase III (Caulobacter crescentus NA1000)
MPQAVIAATGLYTPPHSISNAELVEAFNTFVERFNAANAEAIAAGEVVALPPSSPEFIEK
ASGIKSRFVMDKSGIIDPEIMRPILPERPNEEISILAEMAVEAAKQAIARWGKPVSEIGA
VICAASNMQRAYPAMAIEVQQALGIEGFAFDMNVACSSATFGIKTAADFITTGSAKAVLM
VNPEICSGHLNFQDRDSHFIFGDVATAVIIEDADQAKGGWEIVGTRLKTQFSNNIRNNFG
FLNRAAPEGVGAKDKLFVQEGRKVFREVVPMVSEMIVEHAKDLGVDPTGLKRLWLHQANI
NMNEMIGRKVLGRDPAPGENVIILDEYANTSSAGSIIAFHSANDDFAPGETGLICSFGAG
YSAGTVFVRKR