Protein Info for CCNA_01507 in Caulobacter crescentus NA1000

Annotation: cystine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 90 to 102 (13 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 115.1 bits, see alignment E=9.1e-38 PF00528: BPD_transp_1" amino acids 33 to 214 (182 residues), 93.9 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 64% identical to YECS_SHIFL: L-cystine transport system permease protein YecS (yecS) from Shigella flexneri

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to ccr:CC_1440)

MetaCyc: 64% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C842 at UniProt or InterPro

Protein Sequence (219 amino acids)

>CCNA_01507 cystine transport system permease protein (Caulobacter crescentus NA1000)
MDTGLDLLRQSAPLLLKGAGYTIVLSVIGMSIGVVLGFLLALMRLSRSALLRWPAGVYVS
AFRGTPLLVQLFLIYYGLPQFGLEMPPLVAAGIGFSLNVAAYSCEILRSAIAAVDKGQWE
AASVLGMSRGQTLRRVILPQAARTAVAPLSNSFISLVKDTSLAATIQVPELFRQAQLITA
RTYEIFTLYLAAAAIYWILSTILAAAQTRLERRAAEGRR