Protein Info for CCNA_01502 in Caulobacter crescentus NA1000

Annotation: conserved membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 76 to 104 (29 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details PF05661: DUF808" amino acids 3 to 299 (297 residues), 390.2 bits, see alignment E=3e-121

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 100% identity to ccs:CCNA_01502)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C885 at UniProt or InterPro

Protein Sequence (314 amino acids)

>CCNA_01502 conserved membrane spanning protein (Caulobacter crescentus NA1000)
MPSGLAALLDDVAAITKLAAASLDDVGAAAGKAGTKAVGVVVDDAAVTPGYAIGFTPDRE
LPIVWKIAMGSLRNKLIFLLPGALILSAFAPWAVTPILMLGGAYLAFEATEKVLEAFTPE
AEGEAIEELALSGPDLEKQKVDGAIRTDLILSGEIMAIALAEVAHLSLAMQAGALALVGV
LLTVGVYGAVALIVKMDDIGLHLSRRPNKGSQALGRGLVKAMPVTMEALTVIGTAAMLWV
GGGIIVHGLEHFHLTPIPHWVEGLSHWAGQAPVVGPVTGWLAFALGSAVVGLVIGGVLAG
VMHLWHHRKGAAAH