Protein Info for CCNA_01497 in Caulobacter crescentus NA1000

Annotation: ADP-L-glycero-D-manno-heptose-6-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 6 to 155 (150 residues), 31.3 bits, see alignment E=3.5e-11 TIGR02197: ADP-glyceromanno-heptose 6-epimerase" amino acids 6 to 327 (322 residues), 424.5 bits, see alignment E=1.2e-131 PF01370: Epimerase" amino acids 6 to 254 (249 residues), 133.4 bits, see alignment E=2.8e-42 PF01073: 3Beta_HSD" amino acids 7 to 128 (122 residues), 35.5 bits, see alignment E=1.7e-12 PF16363: GDP_Man_Dehyd" amino acids 7 to 304 (298 residues), 58.6 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 52% identical to HLDD_DESVV: ADP-L-glycero-D-manno-heptose-6-epimerase (hldD) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K03274, ADP-L-glycero-D-manno-heptose 6-epimerase [EC: 5.1.3.20] (inferred from 100% identity to ccr:CC_1430)

Predicted SEED Role

"ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)" in subsystem LOS core oligosaccharide biosynthesis (EC 5.1.3.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C831 at UniProt or InterPro

Protein Sequence (333 amino acids)

>CCNA_01497 ADP-L-glycero-D-manno-heptose-6-epimerase (Caulobacter crescentus NA1000)
MSRRIVLVTGGAGFIGSNIVARLCEDPALDVVVCDRLRDAASGKWRNIAKHAIADFVAPE
QLFDWLAKRGGEVELVVHMGAVSSTTEVDADKIVQSNFVLSRDLWDWCAQHGKRLIYASS
AATYGDGALGFDGKDDLASLQALRPLNAYGWSKALFDIYAVREAQRGRAPAQWAGLKFFN
VYGPNEDHKGGMKSVAAQIWPRIAAGEGVKLFKSHHPDYEDGGQLRDFVYVRDVVDVVGW
LAKSPAVNGVFNLGSGQARSFRDLAVATFEAAGRAPDITYIDMPEVLRGKYQYYTQADMS
RLRAAGYNAPMTALEDGVADYVAGYLNTEDPYR