Protein Info for CCNA_01496 in Caulobacter crescentus NA1000

Annotation: 2-dehydro-3-deoxyphosphooctonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00793: DAHP_synth_1" amino acids 21 to 273 (253 residues), 251.6 bits, see alignment E=3.3e-79 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 30 to 285 (256 residues), 430.7 bits, see alignment E=7.5e-134

Best Hits

Swiss-Prot: 100% identical to KDSA_CAUVC: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 100% identity to ccr:CC_1429)

MetaCyc: 51% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H5A9 at UniProt or InterPro

Protein Sequence (287 amino acids)

>CCNA_01496 2-dehydro-3-deoxyphosphooctonate aldolase (Caulobacter crescentus NA1000)
MDQPKAVAPNAVVEIKTPTGAPVRIGNGEKLSIIAGPCQMESRQHALETAHALKEMADRL
GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTLTDVHETSHCSIVAEA
VDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGNPNVMACER
GASFGYNTLVSDMRALPIMKEIGCPVVFDATHSVQQPGGQGTSSGGQREFVPTLARAAVA
VGVACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTKAA