Protein Info for CCNA_01494 in Caulobacter crescentus NA1000

Annotation: cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF02353: CMAS" amino acids 141 to 408 (268 residues), 286.5 bits, see alignment E=7.3e-89 PF01728: FtsJ" amino acids 185 to 238 (54 residues), 25.4 bits, see alignment 4.2e-09 PF13489: Methyltransf_23" amino acids 188 to 345 (158 residues), 42.2 bits, see alignment E=2.6e-14 PF13847: Methyltransf_31" amino acids 197 to 309 (113 residues), 29.5 bits, see alignment E=2.1e-10 PF13649: Methyltransf_25" amino acids 201 to 295 (95 residues), 57.7 bits, see alignment E=5.7e-19 PF08242: Methyltransf_12" amino acids 202 to 296 (95 residues), 46.4 bits, see alignment E=2e-15 PF08241: Methyltransf_11" amino acids 202 to 296 (95 residues), 46.2 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to ccs:CCNA_01494)

Predicted SEED Role

"S-adenosyl-L-methionine dependent methyltransferase, similar to cyclopropane-fatty-acyl-phospholipid synthase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6R6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>CCNA_01494 cyclopropane-fatty-acyl-phospholipid synthase (Caulobacter crescentus NA1000)
MCNRMRDPDLQTALWNDPDLRTAPTAFRAALRVIDGNWDAGSITWILPTGKAFKVTGPNP
GPDATLKVNDYNFMRRAFTSGAIGFAEGFMAGEWETPDLSAVLEAFSLNFDKLGVLVSGN
PLMRAFHGLYHLFHRNSRSGSRKNIHAHYDLGNSFYSQWLDPTMTYSSALYERPGQSLPE
AQRAKYAALARTIDLAPGKHVLEIGCGWGGFAEFAAKEVGAKVTGITISQAQYDFARKRL
FEQGLSEKADIRLVDYRDVEGRYDAVASIEMFEAVGEEYWPAYFSKVRDVLVPGGRAGLQ
IITIRDELFDEYRGQTDFIQRYIFPGGMLPSEARLKEETERAGLEWSDLKRFGQNYADTL
AEWARQFEAAWSEIRKDGFDERFRRLWRFYLSYCEAGFRTERTNVIQLGLSRA