Protein Info for CCNA_01491 in Caulobacter crescentus NA1000

Annotation: cystathionine beta-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF01053: Cys_Met_Meta_PP" amino acids 4 to 379 (376 residues), 296.9 bits, see alignment E=8.6e-93 TIGR01324: cystathionine beta-lyase" amino acids 5 to 381 (377 residues), 671.3 bits, see alignment E=1.5e-206

Best Hits

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to ccs:CCNA_01491)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C825 at UniProt or InterPro

Protein Sequence (386 amino acids)

>CCNA_01491 cystathionine beta-lyase (Caulobacter crescentus NA1000)
MDEETRLIHTGSEPARLGRTVNPPIQRGSTVLLPDAASLYDDDQLTYGITGLSTPVALQN
ALAELEGATNVTLYPSGLAAITGAMLAVLKAGDEVLVVDSAYKPTRRFCDRVLGRFGVTT
RYYDPKLSPEALMGLVTSSTRLIVLEAPGSLTFEMQDIPAIAAAANARGVLTLIDNTWAA
GLLFKPLAHGVTMSVQALTKYVGGHSDCFMGSVATCDDAVAKLLGDAMWDIGWSVSSDDA
YTMLRGLRTLATRLPRHAENGLAIARWLQERPEVARVLHPALPGDAGHAIWKRDFTGACG
LFGVVLKPCSQKAVHAFLDSLKLFGLGFSWGGYESLALNCDPQLGARSIPVDLEGPLLRF
HIGLEGIEDLKADLRRGFEALNAAKA