Protein Info for CCNA_01490 in Caulobacter crescentus NA1000

Annotation: FAD-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details PF21688: FAD-depend_C" amino acids 290 to 486 (197 residues), 273.3 bits, see alignment E=1.7e-85

Best Hits

KEGG orthology group: K07137, (no description) (inferred from 100% identity to ccs:CCNA_01490)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7H0 at UniProt or InterPro

Protein Sequence (546 amino acids)

>CCNA_01490 FAD-dependent dehydrogenase (Caulobacter crescentus NA1000)
MLRISELKLPLGHPPDAMEPAILARLGLSATDLVSFAVARRANDARKKSAIQMVYSVDVV
LRDEAAVLRRFEGDHHLRVTPDTGYHFVAKAPEGFDGPRPVVIGAGPCGLFAGLILAQMG
LKPIIVDRGKVVRERTKDTWGLWRRSELNPESNVQFGEGGAGTFSDGKLYSQIKDPRFLG
RKVLTEFVKAGAPEEILTEAHPHIGTFRLVHMVENMRALIESLGGEYRWQHRVEDFDIEV
GEDGVRRVTGLHIAGQGHLPARHVVMALGHSSRDTFQVLYDRGVHIEAKPFSIGVRIEHP
QSWIDRARFGDCAGHKDLGAAAYAISHHAKNGRTVYSFCMCPGGTVVAATSEPGRVVTNG
MSQYSRNERNANSGFVVDIDPERDYPGHPLAGVDFQRKWESLAFQAGGGTYQAPGQLVGD
FLAGRPSTVFGAVTPSYKPGVHLTDLAQCLPDFAIEAMREALPIFGRQIPGYDHPDVVLT
GVETRTSSPVRITRGKDFQSLNTAGLYPAGEGAGYAGGILSAAVDGIKVAEAVAKQYVAE
GLISAC