Protein Info for CCNA_01449 in Caulobacter crescentus NA1000

Annotation: fructose-1,6-bisphosphatase, FIG superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00316: FBPase" amino acids 16 to 185 (170 residues), 176.3 bits, see alignment E=5.3e-56 PF18913: FBPase_C" amino acids 189 to 320 (132 residues), 156.3 bits, see alignment E=3.6e-50

Best Hits

Swiss-Prot: 100% identical to F16PA_CAUVC: Fructose-1,6-bisphosphatase class 1 (fbp) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to ccr:CC_1385)

MetaCyc: 46% identical to fructose-1,6-bisphosphatase (Arabidopsis thaliana col)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9D9 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_01449 fructose-1,6-bisphosphatase, FIG superfamily (Caulobacter crescentus NA1000)
MTAFVDLAARLAAEPADAALKDVVLTIAETCAQISRVVASGALSGSLGAAGSTNVQDEEQ
KKLDVITNDMLSDALKACGPVAGLASEELEEVEPTGRVGGYLVTFDPLDGSSNIDVNVSV
GTIFSVLPAPAGHAPTEGDFLQPGRNQVAAGYAVYGPQTMLVVTLSGGVNGFTLSADGRW
LLTHPDLAIKPDTAEFAINMSNQRHWAPAVRRYIDGCLQGKDGARGKNFNMRWVASMVAD
VHRIMMRGGVFMYPWDAREPDKPGKLRLMYEANPMSLLAERAGGKSIEGLNEILDINPAK
LHQRVPVVLGSANEVEVIRAEMRAG