Protein Info for CCNA_01412 in Caulobacter crescentus NA1000

Annotation: acyl-CoA dehydrogenase, short-chain specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF02771: Acyl-CoA_dh_N" amino acids 8 to 119 (112 residues), 116.9 bits, see alignment E=1.6e-37 PF02770: Acyl-CoA_dh_M" amino acids 124 to 217 (94 residues), 92.9 bits, see alignment E=2.8e-30 PF00441: Acyl-CoA_dh_1" amino acids 229 to 378 (150 residues), 174.7 bits, see alignment E=3.5e-55 PF08028: Acyl-CoA_dh_2" amino acids 246 to 366 (121 residues), 83.2 bits, see alignment E=5.3e-27

Best Hits

Swiss-Prot: 60% identical to ACAD8_MOUSE: Isobutyryl-CoA dehydrogenase, mitochondrial (Acad8) from Mus musculus

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to ccr:CC_1350)

MetaCyc: 43% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.3.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.- or 1.3.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6G8 at UniProt or InterPro

Protein Sequence (381 amino acids)

>CCNA_01412 acyl-CoA dehydrogenase, short-chain specific (Caulobacter crescentus NA1000)
MRMDFALNEDQVAIQDAARAFAEGQLAPHSADWDENKHFPVDVLRQAAELGFAGIYVNED
VGGSGLSRLDASIIFEALSYGDVPVAAYLTIHNMASWMIDRFGSDDLRQRYLPRLTTMEL
IASYCLTEPGSGSDAAAMRTTAKLDGDHYVLNGGKAFISGGGVSDIYVVMARTGGEGAKG
VSAFVVEKGMEGLSFGANERKMGWNAQPTAQVNFDNCRVPVANRIGQEGEGFRFAMMGLD
GGRLNIASCSLGGAQFALDTAKAYLETRNQFGRPLKDFQALQFKLADMATELEAARLMVR
RAAHALDSKHPEATKLCAMAKRFATDAGFQVANDALQLHGGYGYLQDYPLERLVRDLRVH
QILEGTNEIMRVIIAREMFRQ