Protein Info for CCNA_01409 in Caulobacter crescentus NA1000

Annotation: delta-aminolevulinic acid dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00490: ALAD" amino acids 12 to 330 (319 residues), 441 bits, see alignment E=1.3e-136

Best Hits

Swiss-Prot: 56% identical to HEM2_RHOCA: Delta-aminolevulinic acid dehydratase (hemB) from Rhodobacter capsulatus

KEGG orthology group: K01698, porphobilinogen synthase [EC: 4.2.1.24] (inferred from 100% identity to ccs:CCNA_01409)

MetaCyc: 56% identical to porphobilinogen synthase subunit (Rhodobacter capsulatus)
Porphobilinogen synthase. [EC: 4.2.1.24]

Predicted SEED Role

"Porphobilinogen synthase (EC 4.2.1.24)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C809 at UniProt or InterPro

Protein Sequence (334 amino acids)

>CCNA_01409 delta-aminolevulinic acid dehydratase (Caulobacter crescentus NA1000)
MTTPPLAPYPHTRLRRVRQSDWVRRLVRETEVRPSDLIWSMVVHEGEGTIPVASMPGVER
LSVKEAAKAAVRARDLGIPAIAIFPHIDGSRKDAAGSIAADPDGVIPRAVKAMKDAAPEV
GIMCDVALDPFTDHGHDGVVEGGKILNDATIERLIEQGLMQADAGADILAPSDMMDGRIG
KLRAALEGANYQDVMIMSYAAKYASAFYGPYRDAIGSAKLSAGQGDKKTYQMDPANTEEA
IREVALDIAEGADMVMVKPGMPYLDILRRLVEEFRMPTYAFQVSGEYAMIMAAAQNGWID
KDRAILESLTAFKRAGAAGIITYFAPWAAEKLGA