Protein Info for CCNA_01406 in Caulobacter crescentus NA1000

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 124 to 142 (19 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details PF10118: Metal_hydrol" amino acids 18 to 266 (249 residues), 264.6 bits, see alignment E=4.9e-83

Best Hits

KEGG orthology group: K07044, (no description) (inferred from 100% identity to ccs:CCNA_01406)

Predicted SEED Role

"FF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6G1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CCNA_01406 metal-dependent hydrolase (Caulobacter crescentus NA1000)
MTAATQAKHTPDDLSVAPRDIRFDLTSAQKGHWLGGDPVGTAVFNALSLTFPDGERMFMD
AVKAYRDRLSGKLLEDAKGFIAQEAIHSREHHHLNSLIDRERYPVAEIEETIRGRVKMAR
ERGPMAMLISTIALEHFTAMMAEMHARHRNLFDTTDPEIEKLWRWHAVEETEHKAVAYDV
FLEVTKDWSPLKRYMIRCRAMVFVTIMFTRNISRYAARLLEADGYTPKAALKAVKRFVWG
DPGIFRRGWKTYFAWYRPGFHPWDQDDRPLVADWMAEFNAAAVRV