Protein Info for CCNA_01387 in Caulobacter crescentus NA1000
Annotation: tRNA (uracil-5-)-methyltransferase related protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y1326_CAUVC: Uncharacterized RNA methyltransferase CC_1326 (CC_1326) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to ccr:CC_1326)Predicted SEED Role
"RNA methyltransferase, TrmA family"
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C6E4 at UniProt or InterPro
Protein Sequence (415 amino acids)
>CCNA_01387 tRNA (uracil-5-)-methyltransferase related protein (Caulobacter crescentus NA1000) MQDLTINAIGAQGDGLARTADGKPAFVPLTLPGEVVRAKMDGARGEVVEILAPSPERVAP ACRHYGVCGGCALQHWAAEPYRAWKAEQVRLQLSMEGLETEILPTFAAPPASRRRVALHA RKGGKGQGARLGFKERRSWNLVSIEECPVTDPRLVAALPALARLAEPFLEHPKSAPTLHV TLTATGLDIDITGVERKSGGLSADARMRAAMAAGEGDFARVTLAGETIYGARQPLVKLGQ AVVALPPGSFLQAVPAAEKAMVELAVAEAQGASRVADLYCGVGTFTFPLAEVAQVYAAEM SAPAITALKAAIGGAPGLKPITAEARDLVRRPVLSTELAKTDVVVIDPPRAGAAEQTVEI AKSKVAKVLGVSCNPQTFAKDARVLVDAGFKLVRVTPVDQFVWSPHIELVGVFTR