Protein Info for CCNA_01385 in Caulobacter crescentus NA1000

Annotation: rRNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01479: S4" amino acids 5 to 51 (47 residues), 40.7 bits, see alignment 1.6e-14 TIGR00478: TlyA family rRNA methyltransferase/putative hemolysin" amino acids 5 to 235 (231 residues), 208.4 bits, see alignment E=4.7e-66 PF01728: FtsJ" amino acids 59 to 240 (182 residues), 125.9 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 46% identical to TLYA_MYCTO: 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA (tlyA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06442, putative hemolysin (inferred from 100% identity to ccs:CCNA_01385)

MetaCyc: 46% identical to 16S rRNA (cytidine1409-2'-O)-methyltransferase [multifunctional] (Mycobacterium tuberculosis H37Rv)
RXN-12462 [EC: 2.1.1.227]; RXN-12463 [EC: 2.1.1.227, 2.1.1.226]

Predicted SEED Role

"RNA binding methyltransferase FtsJ like"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.226 or 2.1.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7Y8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>CCNA_01385 rRNA methylase (Caulobacter crescentus NA1000)
MARKRIDQLLVDRGVFDSRAKARAAIEAGRVSVAGRVVAKPSEQVDDNAEVAAEAAHPWV
GRGALKLVHALDTWPIAVEGRVAIDVGASTGGFTEVLLSRGAAFVFAVDVGRDQLHPSLR
ASDRVADLSGVDARSLDDDRIAQPPGLIVSDVSFISLTKALPAALHLATRGAELVALIKP
QFEAGREHVGKGGLVKDPDVIARVEREIVAFLEAAGWSVRGLAESPITGGEGQIERLVWA
TKL