Protein Info for CCNA_01372 in Caulobacter crescentus NA1000

Annotation: lysine decarboxylase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00730: TIGR00730 family protein" amino acids 10 to 179 (170 residues), 173.2 bits, see alignment E=2.3e-55 PF18306: LDcluster4" amino acids 16 to 121 (106 residues), 60.8 bits, see alignment E=1.2e-20 PF03641: Lysine_decarbox" amino acids 53 to 180 (128 residues), 142.8 bits, see alignment E=7.6e-46

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 100% identity to ccs:CCNA_01372)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6D2 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CCNA_01372 lysine decarboxylase family (Caulobacter crescentus NA1000)
MSDESRRLSAVCVYCGSSNDADPSYIAAAFSIGESFAKAGLKLVYGGGGVGLMGATARGA
HTAGGAVLGIIPSFLRGREQPFDDVETVVVDNMHERKMMMFERSDAFVVLPGGIGTLEEI
VELLSWRRLDLHQKPIVFHNPGGFWDPLFVLIRHTIDQGLTPPDLANAWRAVERAEDVTP
ALLAWDAEIYQSGAPDTLRRLT