Protein Info for CCNA_01367 in Caulobacter crescentus NA1000

Annotation: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF02277: DBI_PRT" amino acids 32 to 294 (263 residues), 158.1 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 49% identical to COBT_AGRFC: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 100% identity to ccs:CCNA_01367)

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C745 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_01367 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Caulobacter crescentus NA1000)
MTDQTVSPFADIRQLASSPPQPGPTPALEQGGRLAEIAAWLTAWTGKTPPAVNRPVVALY
AGARQGVGPRGWARERLEAIAAGGATVSRLAGVQGAGLEAFDLAIDRPSPDMVSKASMSE
KEAAATMAFGMEALAKQPDLLIPGVIAAEPARTAAAVCLALFGGEASDWSSDPEPVAAAV
ARAREEGMGDDPLEILRQLGGRETAAVAGAILAARVQKTPVLLDGYAACAAAAIVQAVEP
TAIDHCLAAHVSPARGHAKLLEKLGKQPLLSLGAEDEEGVGGVSALALVKLACEAR