Protein Info for CCNA_01358 in Caulobacter crescentus NA1000

Annotation: myo-inositol catabolism protein IolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04379: myo-inosose-2 dehydratase
  • amino acids 3 to 289 (287 residues), 380.2 bits, E=3.9e-118
• PF01261: AP_endonuc_2
  • amino acids 31 to 281 (251 residues), 117.6 bits, E=4.1e-38

Best Hits

Swiss-Prot: 46% identical to MOCC_RHIML: Rhizopine catabolism protein MocC (mocC) from Rhizobium meliloti

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 100% identity to ccs:CCNA_01358)

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• Inositol phosphate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

See A0A0H3C7Q5 at UniProt or InterPro

Protein Sequence (299 amino acids)

>CCNA_01358 myo-inositol catabolism protein IolE (Caulobacter crescentus NA1000)
MTIRFGVSPIAWINDDMPELGGDTPLESVLADCQAIGFEGVELGGVFPRDPAVLKPLLDR
YGLDLVGGWYSGNLLAHSAEDEIAALQPHLALLKAMGCTVFIHAETSNAIHGARDTALSA
TPRLDAEGWTLFGARLTKVADYIAAQGLKFAYHHHLGTVVERPQDLEAFLGATGPSVGLT
VDTGHAALGGVDPVALIRAHPERVAHVHCKDVRREVFQSVIGQKGGSFLDGVLAGMFTVP
GDGGLDYAAVMQALAEINYSGWIIVEAEQDPAIANPRQYGEMGLATLKKEAAATGLRAA