Protein Info for CCNA_01357 in Caulobacter crescentus NA1000

Annotation: myo-inositol catabolism protein IolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase
  • amino acids 5 to 611 (607 residues), 934.4 bits, E=1.7e-285
• PF02776: TPP_enzyme_N
  • amino acids 7 to 132 (126 residues), 63.1 bits, E=3.3e-21
• PF00205: TPP_enzyme_M
  • amino acids 220 to 353 (134 residues), 126.5 bits, E=9.6e-41
• PF02775: TPP_enzyme_C
  • amino acids 417 to 568 (152 residues), 112.9 bits, E=1.9e-36

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to ccr:CC_1299)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

See A0A0H3C735 at UniProt or InterPro

Protein Sequence (614 amino acids)

>CCNA_01357 myo-inositol catabolism protein IolD (Caulobacter crescentus NA1000)
MALVRLTAAQATVRWLAAQHVETSDGEVPYFAGVWAIFGHGNVAGLGEALHGVRDVLLTY
RAHNEQGMAHAAIAFAKQSRRERAMVCTTSIGPGATNMVTAAALAHVNRLPVLFLPGDVY
ASRRPDPVLQQIEDFGDGTISANECFKPVSRYFDRITRPEQILDALPRALAVMLDPATCG
PATLAFCQDVQAEAFDYPQAFFAKRVWRIRAPQPDPRELDDLVGLIKAAERPLIVAGGGV
LYARAEAALADLANDAGLPVVETQGGKGSLAWDHPLNLGAVGVTGTTASVAAAEAADLVI
GLGTRLQDFTTGSRALFGAEGRKLVQVNVAPHDAHKHGATSVVGDALAVLEALAERLDGW
RAPVAWTDQATSGVPAWNAIFDASTRADTRPLPTDAQVLGAVWRASSDDSVVVCAAGGLP
GELHKLWRTRMPGGYHVEYGFSCMGYEIAGAVGVKMAEPDREVHVMVGDGSYLMLNSELA
TSVMLGTKLIVTVLDNRGYGCINRLQAATGGAAFNNLLADTLHETLPDIDFAAHAASLGA
RSEKVGDLSSLEAALQRAKASDRTYVVVIDTDPMPTTEGGAWWDVAVPEVSVRPSVNAAR
ADYDLKIKQQRTGD