Protein Info for CCNA_01354 in Caulobacter crescentus NA1000

Annotation: myo-inositol 2-dehydrogenase IdhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR04380: inositol 2-dehydrogenase" amino acids 2 to 327 (326 residues), 439.9 bits, see alignment E=2.4e-136 PF01408: GFO_IDH_MocA" amino acids 4 to 118 (115 residues), 66.9 bits, see alignment E=2.8e-22 PF02894: GFO_IDH_MocA_C" amino acids 131 to 328 (198 residues), 81.3 bits, see alignment E=9.5e-27

Best Hits

Swiss-Prot: 47% identical to MI2D_RHIME: Inositol 2-dehydrogenase (idhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 100% identity to ccs:CCNA_01354)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7V9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>CCNA_01354 myo-inositol 2-dehydrogenase IdhA (Caulobacter crescentus NA1000)
MHDIAILGAGRIGRIHAKNVASQPGLRLKYVVDPVAAAADGLAGETGASVADLETALNDP
AVAGVIVASSTDTHLDYSLKAIAAGKAVFCEKPIDQDLARARSASGELGGKGVKLFLGFN
RRFDPNFQGLKARLSAGVVGALETVHITSHDPAPPPVSYVKVSGGLFKDMTIHDFDMARW
LLDEPVSEVFAAASCLVDPAIGEAGDVDTAKILLRTASGKICMISNSRRSGYGYDQRIEA
FGSKGLVRADNVMESTVSIWGENGAASDAFQNFFLDRYAEAYRREMAHFAEIIRGEALPS
VGYVDGVEALALAEAAGLSAKTGQVVKL