Protein Info for CCNA_01342 in Caulobacter crescentus NA1000

Annotation: ATPase, AAA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF05496: RuvB_N" amino acids 22 to 139 (118 residues), 44 bits, see alignment E=7.5e-15 PF00004: AAA" amino acids 55 to 164 (110 residues), 58.4 bits, see alignment E=3.9e-19 PF07728: AAA_5" amino acids 55 to 144 (90 residues), 29.3 bits, see alignment E=2.7e-10 PF16193: AAA_assoc_2" amino acids 184 to 259 (76 residues), 70.6 bits, see alignment E=3.7e-23 PF12002: MgsA_C" amino acids 260 to 425 (166 residues), 225 bits, see alignment E=1.8e-70

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to ccs:CCNA_01342)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C719 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CCNA_01342 ATPase, AAA family (Caulobacter crescentus NA1000)
MSDLFQAAGLTPHAPSPLADRLRPQSLDEVVGQQHLLGPEGPIGRMAAARRLASMILWGP
PGTGKTTIARLLAKAGGYEFMQISAVFSGVADLKKAFEQARARRMAGQSTLLFVDEIHRF
NRAQQDGFLPFVEEGIVTLVGATTENPSFELNGALLSRCQVFVLKRLTEESLELLLQRAE
AAENRPLPIDAEARSALVAMADGDGRYLLTLAETLFSIGTDTPLNPTQLGQFLQKRRPAY
DKDREEHYNLISALHKSVRGSDPDAALYWLARMLEGGEDPLFIARRLVRMASEDIGAADP
LSLLLTTAAKDAYDFLGSPEGELALAQAVVHMASAPKSNAVYTAYKAARRAAKETGSLMP
PSHILNAPTKLMKSLGYGDGYAYDHDVEGGVSGQNYFPDGMERRRFYEPKPVGAEAKVRE
RLEAWGKVRKDGK