Protein Info for CCNA_01340 in Caulobacter crescentus NA1000

Annotation: major facilitator superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 363 (347 residues), 171.9 bits, see alignment E=2.8e-54 amino acids 227 to 412 (186 residues), 54.8 bits, see alignment E=1.1e-18 PF06609: TRI12" amino acids 33 to 145 (113 residues), 23.2 bits, see alignment E=3.4e-09 PF00083: Sugar_tr" amino acids 65 to 193 (129 residues), 42.4 bits, see alignment E=6.7e-15

Best Hits

KEGG orthology group: K08151, MFS transporter, DHA1 family, tetracycline resistance protein (inferred from 88% identity to cse:Cseg_1526)

Predicted SEED Role

"Tetracycline-efflux transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C939 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CCNA_01340 major facilitator superfamily transporter (Caulobacter crescentus NA1000)
MNTTITGGRRQAALGFIFVTAILDVLSLGVMIPVLPNLVKAFGGGDTAAAADWNVLFATT
WGVMQFICSPILGLLSDRFGRRPVILTSIFGLGIDFLFMAFAPNLWWLFIGRIFNGMTAA
SFSTASAYVADVTTPENRAKGFGLMGAAFGIGFTFGPALGGWLWEFDHRAPFLVCAALAL
TNWLYGFFVLPESLPPERRQPRFDWKKANPIGSLQLLRHHPGLMGLAGVGFLFQLAHNVL
PSVFVLYMGFRYGWSPQTIGLTLMASGIASILIQAFVVGPAVKRLGERGVLLIGLFAGFL
GFSIYALAPTSLLYLAGLPIFAFSGLIQPGLQGLMTRRVGPNEQGQLQGANAAMMGIASI
IGPPLFLIPFAFAVRHDATLHLPGLPILIAAVLMLAATLLAYAKAKPAPAPEPQPA