Protein Info for CCNA_01307 in Caulobacter crescentus NA1000
Annotation: LSU ribosomal protein L1E-L4P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL4_CAUVC: 50S ribosomal protein L4 (rplD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K02926, large subunit ribosomal protein L4 (inferred from 100% identity to ccr:CC_1249)Predicted SEED Role
"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8H4D5 at UniProt or InterPro
Protein Sequence (212 amino acids)
>CCNA_01307 LSU ribosomal protein L1E-L4P (Caulobacter crescentus NA1000) MKLDVIKLDGGKAGSVDLDDAIFGIDEIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRT SKKMYKQKGTGGARHGSRRAAQFVGGAKAHGPVVRSHAFDLPKKIRALALRHALSSKAKA GSLVVVDSVALTEAKTAALRATFDKIGLKNALVIAGPEVDANFKLAARNIPNVDVLPNAG LNVYDVLRRQTLVLTKDAVEAISARFAEKEAA