Protein Info for CCNA_01300 in Caulobacter crescentus NA1000

Annotation: formate dehydrogenase accessory protein fdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF02634: FdhD-NarQ" amino acids 29 to 264 (236 residues), 223.2 bits, see alignment E=2.1e-70 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 29 to 264 (236 residues), 173.3 bits, see alignment E=2.7e-55

Best Hits

Swiss-Prot: 41% identical to FDHD_XANC5: Sulfur carrier protein FdhD (fdhD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to ccr:CC_1242)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7T3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>CCNA_01300 formate dehydrogenase accessory protein fdhD (Caulobacter crescentus NA1000)
MSRSVADPRPALQWRADQAVRPIERITPQEIAVGLSFDGRPHTVLMASPEGLEDLARGFV
VTEAVAAAQDIAAIDIRSEEQGVLVDVRFHPGAGPRKARPRNLEGRSSCGLCGVERLADA
VRPLPVLAASDVTLAHAVIPHALARLEVEQALGRLTRATHAAAFFSLDGDLVLLREDVGR
HNALDKLAGGLLGDGHDPTAGFVVVTSRCSFEMVEKTVRMGCPILVAVSAPTALAIDRAQ
AANLTLVALARADGHAVFAGEERLVVAEMETV