Protein Info for CCNA_01285 in Caulobacter crescentus NA1000

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR01249: prolyl aminopeptidase" amino acids 23 to 325 (303 residues), 422.1 bits, see alignment E=6e-131 PF00561: Abhydrolase_1" amino acids 52 to 310 (259 residues), 125.3 bits, see alignment E=3.3e-40 PF12146: Hydrolase_4" amino acids 73 to 156 (84 residues), 33 bits, see alignment E=4.1e-12

Best Hits

Swiss-Prot: 55% identical to PIP_SERMA: Proline iminopeptidase (pip) from Serratia marcescens

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to ccs:CCNA_01285)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7R9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CCNA_01285 proline iminopeptidase (Caulobacter crescentus NA1000)
MDRYAFATAMSSVGRRSLFREVEPFSFGWMPTSGPHEIYYEECGNPRGKPCVILHGGPGG
AVNPTMRRFFDPAKWRMALFDQRGCGRSRPNASLDDNTTWSLIEDIERLREHLGVEKWTV
FGGSWGSTLALAYAIKHPDRVEGLVLRGIFLLTEKELRWFYQDGASMLFPDAWERFLAPI
PEDERGDLMAAYHRRLVAPDRRVQLEAAAAWSQWEGDTISLRGPEARPPKFNEEDFAIAF
ARIESHFFTNKGFFDEDDWILKNIDRIRGIPGWIVQGRFDVVTPLDSAWRLHKAWPEARF
EIIWDAGHASTEPGVIDGLVRATEAALVS