Protein Info for CCNA_01257 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 209 to 235 (27 residues), see Phobius details amino acids 239 to 240 (2 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details PF06166: DUF979" amino acids 6 to 316 (311 residues), 400.7 bits, see alignment E=2.3e-124

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01257)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7I3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>CCNA_01257 hypothetical protein (Caulobacter crescentus NA1000)
MIGLPLVYLLSGLMFAAFAVLSAGDRENPKRFGNAAFWGLFALSFLAGDHLGDLGNGVLV
LCLAVIAGTGQLGVGAPKTTSPEDRERLATSYGVRLYVPALVIPVLVLAGSLTFKHLTFQ
GAHLVDPKQATLIALALAALVAAVLSKVMFQQPAGAPIQEGRRLMDLVGWAALLPQMLAA
LGAVFALAGVGKSIGEIAVMITPADSRFAAVAAYCVGMAVFTIMMGNAFAAFPVMTGGIA
LPLVIGQFGGDPAVVCAIGMLSGFCGTLLTPLAANFNLVPAALLQLKDRYAVIRAQAPTA
VLMLIVNVILMNALAFHR