Protein Info for CCNA_01249 in Caulobacter crescentus NA1000

Annotation: ABC-transporter substrate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 246 to 264 (19 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 27 to 213 (187 residues), 53.9 bits, see alignment E=9.2e-19

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to ccr:CC_1191)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C630 at UniProt or InterPro

Protein Sequence (268 amino acids)

>CCNA_01249 ABC-transporter substrate binding protein (Caulobacter crescentus NA1000)
MNAAKAFCALAAAMVLVPAGAWAAPRVMSLDSCADQYVLALAPREAIVGLSHRAVAPDSY
LRDKAAGLPLRRATFESLVSARPALVVRQWGGDARLTKALQAKGVATVTLDDATDFDGVR
ANVRKVAVALDRRPQGEALIAGMDARLKAAAGAGRGRETLYLTPSGYTAGANTLIDAMLR
AAGYANATKAAYFAPVSLEQMVMTPPAAVVLGMFDRARAGADRWGPGRHAALRRAVETRA
VAELPAAMVGCSAWFAADAALVLARAAR