Protein Info for CCNA_01247 in Caulobacter crescentus NA1000

Annotation: CESA-like glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 50 to 68 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 362 to 391 (30 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 112 to 341 (230 residues), 81.2 bits, see alignment E=2.5e-26 PF00535: Glycos_transf_2" amino acids 116 to 240 (125 residues), 45.6 bits, see alignment E=1.5e-15 PF13506: Glyco_transf_21" amino acids 173 to 339 (167 residues), 22.1 bits, see alignment E=1.9e-08 PF13632: Glyco_trans_2_3" amino acids 199 to 363 (165 residues), 60.5 bits, see alignment E=4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01247)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7N7 at UniProt or InterPro

Protein Sequence (478 amino acids)

>CCNA_01247 CESA-like glycosyltransferase (Caulobacter crescentus NA1000)
MAREDRRLEPALAPARGPVSVEQGEILRGGPGAGVPDRDGAHRSLSRPQAVGVAIAGLLA
ALGVALAPMESMVATHHLFFFIFLLGGLTRLAAAMTPLPRHHSPALAEADLPSYTLITPL
YREAEVLPELVASLAAIDYPRDRLQALIVLEADDEVTRAAARALDLPSFIQVLVVPPGTP
RTKPRACNYALERARGDLVVIYDAEDMPDPGQLREAAARFAASDARLACLQAPLRIEDPG
FSLFLPSQFRLEYAAHFEVLLPALARWGLPFPLGGTSNHFKIAPLREIGAWDPYNVTEDA
DVGFRLAAAGYRLDVIHRPTWETAPTTRAQWFPQRARWIKGHMQTLAVHARGPVPRQPRN
AIALILTLAQSVASSHLHGPVMGVAIALALVDFLPDAAFQIPPHDLVLYFAGWGAAALAG
ARGVMRAGGRPKALHLLGMPAYWLCQSVAAVKALHQFVTAPHHWDKTLHTPRSGRPRA