Protein Info for CCNA_01246 in Caulobacter crescentus NA1000

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF03602: Cons_hypoth95" amino acids 128 to 242 (115 residues), 27.2 bits, see alignment E=2.9e-10 PF10672: Methyltrans_SAM" amino acids 132 to 217 (86 residues), 30.6 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to ccs:CCNA_01246)

Predicted SEED Role

"SAM dependent methyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7H4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>CCNA_01246 methyltransferase (Caulobacter crescentus NA1000)
MAPKIAPAPIVMRTTGWADYALLDSGHGKKLERYGRYTVVRPEPQCFWAPRLDQTVWDNA
DAVFDPTDEDEAGRWRFKGKPIEKFDLAWGQAKFHGQFTPFRHLAFFPEQAANWAWQDER
VRALCAGSGPQPKVLNLFGYTGVASLVCAAAGAAVTHVDASKKSVGFARENAAFAGLADK
PIRWIVEDARKFVAREVRRGNTYDGIILDPPKFGRGADGEVWRLFEDLAALTKDCAALLS
QDASFLLMNAYAARVSGAAMSGLLAQELQGRGGVIDWGELSLVEEKGDRQIGLSFFARWS
SEG