Protein Info for CCNA_01236 in Caulobacter crescentus NA1000

Annotation: general stress protein GsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10685: KGG
  • amino acids 22 to 39 (18 residues), 33.6 bits, 1.9e-12
  • amino acids 48 to 64 (17 residues), 22.7 bits, 5.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01236)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (10/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

See A0A0H3C7G4 at UniProt or InterPro

Protein Sequence (77 amino acids)

>CCNA_01236 general stress protein GsiB (Caulobacter crescentus NA1000)
MTSPHEEPQMDTDSERPRGRRGFAAMDPERRREIARKGGASVPSEKRSFAKDRDLAANAG
RKGGSTSRGARPGERSL