Protein Info for CCNA_01233 in Caulobacter crescentus NA1000

Annotation: haloalkane dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 48 to 152 (105 residues), 81.9 bits, E=9.1e-27
• PF12146: Hydrolase_4
  • amino acids 48 to 186 (139 residues), 40.1 bits, E=4.1e-14
• PF12697: Abhydrolase_6
  • amino acids 49 to 290 (242 residues), 64.5 bits, E=3.5e-21

Best Hits

Swiss-Prot: 100% identical to DHMA_CAUVC: Haloalkane dehalogenase (dhmA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 100% identity to ccs:CCNA_01233)

Predicted SEED Role

"Hydrolase, alpha/beta fold family protein, At1g52510/AT4G12830 homolog, group4"

MetaCyc Pathways

• 1,2-dichloroethane degradation (2/4 steps found)
• γ-hexachlorocyclohexane degradation (5/11 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Naphthalene and anthracene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

See B8H3S9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CCNA_01233 haloalkane dehalogenase (Caulobacter crescentus NA1000)
MDVLRTPDERFEGLADWSFAPHYTEVTDADGTALRIHHVDEGPKDQRPILLMHGEPSWAY
LYRKVIAELVAKGHRVVAPDLVGFGRSDKPAKRTDYTYERHVAWMSAWLEQNDLKDIVLF
CQDWGGLIGLRLVAAFPERFSAVVVSNTGLPIGVGKSEGFEAWLNFSQNTPELPVGFILN
GGTARDLSDAERSAYDAPFPDESYKEGARIFPALVPITPEHASVEENKAAWAVLETFDKP
FVTAFSDADPITRGGEAMFLARVPGTKNVAHTTLKGGHFVQEDSPVEIAALLDGLVAGLP
QA