Protein Info for CCNA_01214 in Caulobacter crescentus NA1000

Annotation: YjgP/YjgQ family membrane permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details PF03739: LptF_LptG" amino acids 16 to 367 (352 residues), 216.3 bits, see alignment E=3.2e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01214)

Predicted SEED Role

"FIG00482480: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6S8 at UniProt or InterPro

Protein Sequence (406 amino acids)

>CCNA_01214 YjgP/YjgQ family membrane permease (Caulobacter crescentus NA1000)
MSAKDLPNGGPRLIDRYLLRLLLWPLAACLGVTVIALLLERILRLLDVLSQSSARFGYVA
QLAANLVPHYLGLALPVAFFVALFIVIVKLSDGSEIDALLASGQSLERIAAPFVAVGVLL
SVFSIIVFGYMQPYSRYAYRAVMHAAVNAGWNGRLAGGAFIDDKGSLLTADSADIAGQRL
TRVFIRRLDAKGQEEIITAASADLKMDPDGKTITMDLRDGRRIAHDAYGTYRNLAFTSLT
TQTPLSAAAVLLRDRGGDERELTMGELRREAKSPDPVVSKGTLLSEFYGRLARAAFLPFL
PLLAFPLGLASKRGNRAPGLIMAGLLLLAFQHSLLLGQGMAKAGKADAFAAIWIPFTLFA
ALSVWLFVGSRTRPGDTPVSRLVRRINTLVTHALRLLPQPKKRQAA