Protein Info for CCNA_01207 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details PF07730: HisKA_3" amino acids 202 to 266 (65 residues), 62.1 bits, see alignment E=5.8e-21 PF02518: HATPase_c" amino acids 301 to 386 (86 residues), 29.2 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K07778, two-component system, NarL family, sensor histidine kinase DesK [EC: 2.7.13.3] (inferred from 100% identity to ccr:CC_1149)

Predicted SEED Role

"sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5Y9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CCNA_01207 two-component sensor histidine kinase (Caulobacter crescentus NA1000)
MTVTIQARDIEPMNHDPSTVSSGVAQQSGQAQPYSRKGWVQRWHLIWLIYIPFYFLSWIY
RKPGLLEVMASLGGVCFFFFLYWRLWRQRGKAELWQVLAVFCIGLALSRFNVGWSVYTIY
AMSFAARMPSRQMAVRTMIALELVLIALGPVLQPHGLSAWASGVIFGAVVGFASLMQGDM
ERKNEALAIAHEEVRALAATAERERISRDLHDLLGHTLTLVAVKAELAARLVSRDASAAE
REMQAVAAAAREALSEVRTAVVGMKGASLAGELDRVRQALAAAGVEADVSALTTDGHPGQ
EAVLAMALREGVTNVIRHAGASRCDISLTPSASALVLTITDNGQGGRLVEGSGLKGMRAR
LAAIGGTLDVKSDKAGTRLVATAPLRAQGEGVS