Protein Info for CCNA_01166 in Caulobacter crescentus NA1000

Annotation: hydroxyacyl-ACP dehydratase HTD2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF13452: MaoC_dehydrat_N" amino acids 55 to 132 (78 residues), 23.1 bits, see alignment E=3.6e-09

Best Hits

KEGG orthology group: K09709, mesaconyl-C4 CoA hydratase (inferred from 100% identity to ccr:CC_1109)

Predicted SEED Role

"COGs COG3777"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8T0 at UniProt or InterPro

Protein Sequence (265 amino acids)

>CCNA_01166 hydroxyacyl-ACP dehydratase HTD2 (Caulobacter crescentus NA1000)
MSPHADWIGRTRKTTAVLEASDLARLAALLNREAPAEVPPAWHWACLAEPVARADIGPDG
HPRRGLFLPPIAATRRMFASADMSFSGALVAGQETDLVETIANIEEKPGASGPLTFVTVD
RVISQANELRVRERQTIVYTSASSAPRVADSGPPPPAAWSQDTATDPVLLFAFSAATSNS
HRIHYDLGYATQVEGYPGLVVHGPLIALLLLDAMPPRAVSRFSFRALKPAFAGETLTAEG
RLIEDGAELWAISGDATLMQARVTF