Protein Info for CCNA_01161 in Caulobacter crescentus NA1000

Annotation: proton/sodium-glutamate symport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 141 to 154 (14 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details PF00375: SDF" amino acids 17 to 423 (407 residues), 335.8 bits, see alignment E=1.8e-104

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01161)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8S5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CCNA_01161 proton/sodium-glutamate symport protein (Caulobacter crescentus NA1000)
MAATQTKSSRFISGFGAQVLIAMVAGLGLGLLARQLGPAEGQAGYVLAETLRQVGQIFVQ
LLRVLVPPLVFTAIVASIANIAQMQNAARLVWRTLFWFAVTALISVVIGIALGLVLQPGL
HASLDAAAAKAPKTHGSWLDFLTGLVPVNILGLAASTKISDAGAASTSLSFNVLQIVVIS
LVTGVAALKVGEAGEAFLKFNASALAIVRKVLWWVIRLTPIGTVGLFGNAVAQYGWTTLG
QLGAFTVAIYAGLGLVLLVVYPVLLALNDLNPIRFFQGAWPAIQLAFVSRSSIGTLPVTE
TVTETRLGVPRAYAAFAVPLGATTKMDGCAAIYPAIAAIFVAQFFGVHLVWSDYLLIVFV
SVIGSAATAGLTGATVMLTLTLSTLGLPLEGAGLLLAIDPILDMGRTAVNVAGQALVPTL
VAKREGILDLEAYNRPGSHADAAFHAAE