Protein Info for CCNA_01130 in Caulobacter crescentus NA1000

Annotation: flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 123 to 150 (28 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 212 to 239 (28 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 11 to 250 (240 residues), 243.1 bits, see alignment E=1.6e-76 PF01311: Bac_export_1" amino acids 12 to 244 (233 residues), 201.2 bits, see alignment E=9.5e-64

Best Hits

Swiss-Prot: 100% identical to FLIR_CAUVC: Flagellar biosynthetic protein FliR (fliR) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to ccr:CC_1076)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C772 at UniProt or InterPro

Protein Sequence (251 amino acids)

>CCNA_01130 flagellar biosynthesis protein FliR (Caulobacter crescentus NA1000)
MNAFATAFQVYVAALVFARVGAMVMTMPGIGDQAIPARIRLSFALLMALILAPLVQNTVG
PIPSTLGGLGGAVIHEVLIGLMIGSVLRLFMTSLTTAGEIISMQTTLSFAQSTNPSMEGS
STAVATFLSMLGLTLVMATDLHHLFIAAIVKSYTIFPFTRAVPVNDAAALAVQTVAQSFS
LGVQLAAPVIVFSLVFNLATGLVGRIMPAFQIFFVASPLSVILGLSLLALSLSGIAMVWT
DRYRELLDIFT