Protein Info for CCNA_01116 in Caulobacter crescentus NA1000

Annotation: histidine protein kinase DivJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 110 (30 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details PF00512: HisKA" amino acids 317 to 384 (68 residues), 75.1 bits, see alignment E=3.7e-25 PF02518: HATPase_c" amino acids 431 to 539 (109 residues), 100.5 bits, see alignment E=7.5e-33

Best Hits

Swiss-Prot: 100% identical to DIVJ_CAUVC: Histidine protein kinase DivJ (divJ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K11357, two-component system, cell cycle sensor histidine kinase DivJ [EC: 2.7.13.3] (inferred from 100% identity to ccr:CC_1063)

Predicted SEED Role

"FIG00481525: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5M8 at UniProt or InterPro

Protein Sequence (585 amino acids)

>CCNA_01116 histidine protein kinase DivJ (Caulobacter crescentus NA1000)
MEFETLPDPFRRPAARAAGLDPAHAWRLGWLAAVCLAAAAALFTADSGGWPVWAALGAGA
LPALVSLIFTREDERTQSWLLVLWAVGGSLAAVLTGGVGGAMAAWCLAPVAAASTQDQPK
RLAEGAALALIGACVAALTQLSGLAPAAPTGPLAFVLGFLALVTTGLGLAAGLLIGRRRQ
GARDDRYASEIIGLETLLDGLPHLAIAVRGQGQVTAVRGAAPPGVTRADLVNRGLTGAAA
PGDRQRLTAAIAQAHREGSASLTFNPALGVERVVALDMHRVAPNQLVGVLRDITVERHRE
HALDQARIDAEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPLSDRYAEYAEL
IHESGGHLLDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGV
LPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISP
EDLERLGRPYEQAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLPVL
LAPMVAATPTPPAAPEAPSAPEPAPTVEEPPPASLGDNVIAFAPR