Protein Info for CCNA_01101 in Caulobacter crescentus NA1000

Annotation: translation initiation factor 3 (IF-3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05198: IF3_N
  • amino acids 12 to 81 (70 residues), 105.9 bits, E=9.5e-35
• TIGR00168: translation initiation factor IF-3
  • amino acids 12 to 173 (162 residues), 215.5 bits, E=1.8e-68
• PF00707: IF3_C
  • amino acids 88 to 172 (85 residues), 132.3 bits, E=4.9e-43

Best Hits

Swiss-Prot: 100% identical to IF3_CAUVC: Translation initiation factor IF-3 (infC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to ccr:CC_1049)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See B8H312 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CCNA_01101 translation initiation factor 3 (IF-3) (Caulobacter crescentus NA1000)
MQTPPVKDGPRINDEIRVPRVLLIDQHGEKQGEMPTASAMEAAEEAGLDLVEIVPNANPP
VCKILDYGKFKFQEQKKKNEARKRQKVVELKEIKLRPNIDSHDYDVKAKAMHRFFEEGDK
VKVTLRFRGREMAHPELGMKLLQKVKADFDEVAKVEYEPRMEGRQMIMILAPR