Protein Info for CCNA_01096 in Caulobacter crescentus NA1000

Annotation: phenylalanyl-tRNA synthetase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF02912: Phe_tRNA-synt_N" amino acids 19 to 87 (69 residues), 81.1 bits, see alignment E=4.8e-27 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 39 to 341 (303 residues), 334.1 bits, see alignment E=4.4e-104 PF01409: tRNA-synt_2d" amino acids 92 to 341 (250 residues), 346.3 bits, see alignment E=9.8e-108

Best Hits

Swiss-Prot: 100% identical to SYFA_CAUVN: Phenylalanine--tRNA ligase alpha subunit (pheS) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 100% identity to ccs:CCNA_01096)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H307 at UniProt or InterPro

Protein Sequence (357 amino acids)

>CCNA_01096 phenylalanyl-tRNA synthetase alpha chain (Caulobacter crescentus NA1000)
MTDLNTLEADVLAQVAAASDLQALDAVRVAAVGKTGSISGLLKTLGAMSPEERKTQGAAI
NALRDKVQDAITQKKAALEAAELDARLASETLDLSLPAPYRRKGSVHPTMQTMDEVVAIF
AEMGFAVAEGPDIEDDFHNFTALNFPEKHPAREMHDTFFFNPKEDGERMLLRTHTSPVQV
RTMVSQKPPIRIIAPGRTYRCDNDATHTPVFHQVEGLVIDKGIHMGHLKWTLETFLARFF
ETDAVTTQFRPHHFPFTEPSAEMDVQCDRSGGEIKIGQGTSWLEILGCGMVHPNVLRACG
IDPDEYQGFAFGMGVDRLGMLKYGMPDLRDMWSSDVRWLSHYGFSAFAAPNPASGLS