Protein Info for CCNA_01064 in Caulobacter crescentus NA1000

Annotation: perosamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GDPPS_CAUVC: GDP-perosamine synthase (per) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K13010, perosamine synthetase (inferred from 100% identity to ccr:CC_1012)

MetaCyc: 46% identical to GDP-4-dehydro-6-deoxy-D-mannose-4-aminotransferase subunit (Vibrio cholerae O1)
RXN-8953 [EC: 2.6.1.102]

Predicted SEED Role

"Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase"

MetaCyc Pathways

GDP-D-perosamine biosynthesis (2/2 steps found)
GDP-N-acetyl-α-D-perosamine biosynthesis (2/3 steps found)
GDP-N-formyl-α-D-perosamine biosynthesis (2/3 steps found)
superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8J5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>CCNA_01064 perosamine synthetase (Caulobacter crescentus NA1000)
MSDLPRISVAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNG
TTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEAL
ITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATF
SFFGNKIITTGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIG
LAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTR
DQVIKDLDALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNLPTHAGLTEADID
RVIAALDQVLV