Protein Info for CCNA_01061 in Caulobacter crescentus NA1000

Annotation: type I secretion adaptor protein RsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 15 to 436 (422 residues), 483 bits, see alignment E=4.2e-149 PF13533: Biotin_lipoyl_2" amino acids 65 to 93 (29 residues), 26.4 bits, see alignment (E = 6.9e-10) PF13437: HlyD_3" amino acids 287 to 390 (104 residues), 31.2 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: K12534, membrane fusion protein RsaE (inferred from 100% identity to ccr:CC_1009)

Predicted SEED Role

"FIG00484097: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6E1 at UniProt or InterPro

Protein Sequence (436 amino acids)

>CCNA_01061 type I secretion adaptor protein RsaE (Caulobacter crescentus NA1000)
MKPPKIQRPTDNFQAVARIGYGIIALTFVGLLGWAAFAPLDSAVIANGVVSAEGNRKTVQ
HLEGGMLAKILVREGEKVKAGQVLFELDPTQANAAAGITRNQYVALKAMEARLLAERDQR
PSISFPADLTSQRADPMVARAIADEQAQFTERRQTIQGQVDLMNAQRLQYQSEIEGIDRQ
TQGLKDQLGFIEDELIDLRKLYDKGLVPRPRLLALEREQASLSGSIGRLTADRSKAVQGA
SDTQLKVRQIKQEFFEQVSQSITETRVRLAEVTEKEVVASDAQKRIKIVSPVNGTAQNLR
FFTEGAVVRAAEPLVDIAPEDEAFVIQAHFQPTDVDNVHMGMVTEVRLPAFHSREIPILN
GTIQSLSQDRISDPQNKLDYFLGIVRVDVKQLPPHLRGRVTAGMPAQVIVPTGERTVLQY
LFSPLRDTLRTTMREE