Protein Info for CCNA_01060 in Caulobacter crescentus NA1000

Annotation: type I protein secretion ATP-binding protein RsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 18 to 556 (539 residues), 809.8 bits, see alignment E=5.4e-248 PF00664: ABC_membrane" amino acids 24 to 277 (254 residues), 35.2 bits, see alignment E=1.7e-12 PF00005: ABC_tran" amino acids 348 to 494 (147 residues), 98 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 46% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12533, ATP-binding cassette, subfamily C, bacterial RsaD (inferred from 100% identity to ccr:CC_1008)

Predicted SEED Role

"FIG00480742: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5F7 at UniProt or InterPro

Protein Sequence (578 amino acids)

>CCNA_01060 type I protein secretion ATP-binding protein RsaD (Caulobacter crescentus NA1000)
MFKRSGAKPTILDQAVLVARPAVITAMVFSFFINILALVSPLYMLQVYDRVLTSRNVSTL
IVLTVICVFLFLVYGLLEALRTQVLVRGGLKFDGVARDPIFKSVLDSTLSRKGIGGQAFR
DMDQVREFMTGGLIAFCDAPWTPVFVIVSWMLHPFFGILAIIACIIIFGLAVMNDNATKN
PIQMATMASIAAQNDAGSTLRNAEVMKAMGMWGGLQARWRARRDEQVAWQAAASDAGGAV
MSGIKVFRNIVQTLILGGGAYLAIDGKISAGAMIAGSILVGRALAPIEGAVGQWKNYIGA
RGAWDRLQTMLREEKSADDHMPLPEPRGVLSAEAASILPPGAQQPTMRQASFRIDAGAAV
ALVGPSAAGKSSLLRGIVGVWPCAAGVIRLDGYDIKQWDPEKLGRHVGYLPQDIELFSGT
VAQNIARFTEFESQEVIEAATLAGVHEMIQSLPMGYDTAIGEGGASLSGGQRQRLALARA
VFRMPALLVLDEPNASLDQVGEVALMEAMKRLKAAKRTVIFATHKVNLLAQADYIMVINQ
GVISDFGERDPMLAKLTGAAPPQTPPPTPPPAPLQRVQ