Protein Info for CCNA_01039 in Caulobacter crescentus NA1000

Annotation: putative hexuronate transporter, major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 388 (355 residues), 174 bits, see alignment E=2.2e-55 amino acids 317 to 435 (119 residues), 39.8 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 50% identical to EXUT_ECO57: Hexuronate transporter (exuT) from Escherichia coli O157:H7

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to ccs:CCNA_01039)

MetaCyc: 50% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8H3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CCNA_01039 putative hexuronate transporter, major facilitator superfamily (Caulobacter crescentus NA1000)
MAVAVPERAPEGSPGGAAMPKLKALRWWIIGLVTLGAVINYLTRSTMGVAAPTLLKELGI
SVTEYSWITSAFQLGIMLQPICGYVLDTLGLRTGFAVFAVAWSLIAMAHGLANSWQGFAV
LRGFLGLAEGSAQPAGMKTVAIWFPAKERGFAGGVFNIGASIGSVLAPPLVVWAVLVWNW
RAAFVLTGVMGLVWVVLWLAFYRSPEKHPSMTDEERAVIAAGQEAHLEAVAARPSILSIL
KQGQFWGIALPRFLADPTWGTLAFWVPLYLSQTRGFDLKQIALFAWMPFVAADLGCMAGP
VIALFLQKRGVTLINARRIAFTLGAVLMTGMMFVGKVESAYAAIALLCLGGFAHQTLSVT
VITMASDLFRRNEVATVAGLAGMMGNLGLLLFSLLIGGLVAKVGYDPFFIALGVLDILGA
ILLWTLVKDPAARAKAAA