Protein Info for CCNA_00996 in Caulobacter crescentus NA1000
Annotation: enoyl-CoA hydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to ccs:CCNA_00996)Predicted SEED Role
"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)
MetaCyc Pathways
- oleate β-oxidation (29/35 steps found)
- adipate degradation (5/5 steps found)
- 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- adipate biosynthesis (4/5 steps found)
- fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- L-valine degradation I (5/8 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- valproate β-oxidation (5/9 steps found)
- benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- phenylacetate degradation I (aerobic) (4/9 steps found)
- superpathway of phenylethylamine degradation (5/11 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
- platensimycin biosynthesis (6/26 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.17
Use Curated BLAST to search for 4.2.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C8D1 at UniProt or InterPro
Protein Sequence (294 amino acids)
>CCNA_00996 enoyl-CoA hydratase (Caulobacter crescentus NA1000) MSTPTFETLLYDVEDGIATITLNRPDRMNAFTARMMKDLIEVFDVTDADDAVKVVIITGA GRAFCAGADLGGGGATFDRTSPQALEREEGKVGDIYRDGGGRVTLRMYDSLKPIIGAING AAVGVGVTMQLPMDIRLASTEAKFGFVFARRGINPEAASSWFLPRLVGLQTALEWCYTGR VFPASEALEKGLVRSLHAPDELLPAARALAREIADNTAPVSVALTRQLLWRMAGADHPME AHKADSRAIQSRGSSGDAKEGVTSFLEKRAPVYPNKVSTDVPDIWPEWEQPEFR