Protein Info for CCNA_00969 in Caulobacter crescentus NA1000

Annotation: two component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 28 to 63 (36 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF00512: HisKA" amino acids 208 to 273 (66 residues), 67.9 bits, see alignment E=9.9e-23 PF02518: HATPase_c" amino acids 321 to 432 (112 residues), 91 bits, see alignment E=1e-29 PF00072: Response_reg" amino acids 458 to 570 (113 residues), 83.2 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0921)

Predicted SEED Role

"FIG00483597: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6W5 at UniProt or InterPro

Protein Sequence (586 amino acids)

>CCNA_00969 two component sensor histidine kinase (Caulobacter crescentus NA1000)
MGWLAKAWSDERLDEVAADTYRLTLSRLISAALVAVIMVFALGPAIATGWLLSLYIGEGL
ALLVTRRFKDGRTGTPRERAWFAWASIPINISWTTLAILLWLHGEDLMKIAAVAIWCGQV
IYTQNFRHQSAALLLLNGLTPMASLLIFPFFFMPDASAAAQTARWGLVLLVGTTLNVMIQ
NRAAARRMDELTRGLREEREKALEAARAKSTFIAVTSHELRTPMNGLLGMAHALQRSTLD
PVQREQIALMIKSGDSLMQLLNDVLDLSRVETGKVELAPIDMSLQDLVGEVVDAWRDAAV
FKNLSLSVDYAPDLPPGVHADPLRIRQVVTNLVSNAIKFTVDGGVRLEVAARPANGGDQR
VSITVADTGPGVPADAMERVFDSFTQADQTISREHGGAGLGLSIARALARQMGGDLVLVP
SGRGACFVFTFAAPACAAPVAAPEEVGANGDALGPLQVLMAEDNAINQLVVRTMLEPLGV
ALTVVENGQEALEAMAERRFHCVLMDINMPVMDGITALEAIRDGRTGNPAMPVIALTASA
MTGDRERFLGLGFDDHLGKPVKPVDLITAIAKAVNPEPPNAGRRAA