Protein Info for CCNA_00963 in Caulobacter crescentus NA1000

Annotation: organic hydroperoxide resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 4 to 134 (131 residues), 184 bits, see alignment E=7.6e-59 PF02566: OsmC" amino acids 38 to 133 (96 residues), 68 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 51% identical to OHRB_BACSU: Organic hydroperoxide resistance protein OhrB (ohrB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0916)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6V9 at UniProt or InterPro

Protein Sequence (138 amino acids)

>CCNA_00963 organic hydroperoxide resistance protein (Caulobacter crescentus NA1000)
MTTLYTTRATVVGGREGHARTEDGLLDVQLSMPKSLGGKETGTNPEQLFAAGYAACFQSA
MGHVARTQKIALAGSTVTGQVSLATAEVGFRLEVALEVETQGLSQADAEALVAAAHAVCP
YSNATRGNIDVAITTKAA